• Home
  • Sitemap
  • Help
  • Technical Support
  • Contact
Antioxidants, Flavonoids & Free Radical Scavengers Other Products
You are here: Product Lines > Bone Metabolism > Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Toolbar - View Selection
 
 Items 1-20 of 22 Page 1 of 2 Select Page: 1 2  >>  
ALX-105-005 Revised 20-May-08
N-Acetyl-L-cysteine
Add to Clipboard
SYNONYMS LNAL
N-Acetyl-3-mercaptoalanine
L-α-Acetamido-β-mercaptopropionic acid
NAC
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-105-005-G001   1 g 16.00 USD Add To Cart
ALX-105-005-G005   5 g 27.00 USD Add To Cart
Product Specification
FORMULA: C5H9NO3S
MW: 163.2
CAS NUMBER: 616-91-1
MERCK INDEX: 14: 88
RTECS: HA1660000
PURITY: ≥99%
APPEARANCE: White to off-white crystalline solid.
SOLUBILITY: Soluble in 5M hydrochloric acid (hot) (100mg/ml); also soluble in water or 100% ethanol; insoluble in chloroform or ether.
SHIPPING: AMBIENT
LONG TERM STORAGE: +4°C

Product Specific Literature References
Modulation of platelet function by free radicals and free-radical scavengers: D. Salvemini & R. Botting; TIPS 14, 36 (1993), (Review) Abstract
Conversion of glyceryl trinitrate to nitric oxide in tolerant and non- tolerant smooth muscle and endothelial cells: D. Salvemini, et al.; Br. J. Pharmacol. 108, 162 (1993) Abstract
Distinct effects of thioredoxin and antioxidants on the activation of transcription factors NF-kappa B and AP-1: H. Schenk, et al.; PNAS 91, 1672 (1994) Abstract
Induction of apoptosis by pyrrolidinedithiocarbamate and N- acetylcysteine in vascular smooth muscle cells: J.C. Tsai, et al.; J. Biol. Chem. 271, 3667 (1996) Abstract; Full Text
Supplementation of N-acetylcysteine inhibits NFkappaB activation and protects against alloxan-induced diabetes in CD-1 mice: E. Ho, et al.; Faseb. J. 13, 1845 (1999) Abstract
Pyrrolidine dithiocarbamate inhibits TNF-alpha-dependent activation of NF-kappaB by increasing intracellular copper level in human aortic smooth muscle cells: A. Iseki, et al.; Biochem. Biophys. Res. Commun. 276, 88 (2000) Abstract
Suppression of NF-kappaB activation and cytokine production by N- acetylcysteine in pancreatic acinar cells: H. Kim, et al.; Free Radic. Biol. Med. 29, 674 (2000) Abstract
Further Categories Containing This Product:
Special Amino Acids
 
 
ALX-153-055 Revised 25-May-07
Carnosine
Add to Clipboard
SYNONYMS β-Alanyl-L-histidine
PRODUCT LINE Nitric Oxide Pathway
PRODUCT CATEGORY Guanylyl Cyclases, Guanosine Phosphate Metabolism / Related Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-153-055-G001   1 g 55.00 USD Add To Cart
Product Specification
SEQUENCE: H-β-Ala-His-OH
FORMULA: C9H14N4O3
MW: 226.2
CAS NUMBER: 305-84-0
PURITY: ≥98%
APPEARANCE: White to off-white powder.
SOLUBILITY: Soluble in 80% acetic acid (10mg/ml).
SHIPPING: AMBIENT
LONG TERM STORAGE: -20°C

Product Description
Antioxidant. Inhibits soluble guanylyl cyclase (sGC) by interacting with the heme iron to form a chelate complex.
Product Specific Literature References
Carnosine as a regulator of soluble guanylate cyclase: I.S. Severina, et al.; Biochemistry (Mosc) 65, 783 (2000) Abstract; Full Text
Further Categories Containing This Product:
Antioxidants, Flavonoids & Free Radical Scavengers Other Products
 
 
ALX-201-172 Revised 10-Jun-05
Metallothionein-3 (human) (recombinant)
Add to Clipboard
SYNONYMS MT-3 (human) (recombinant)
Zn7-MT-3 (human) (recombinant)
Neuronal Growth Inhibitory Factor (human) (recombinant)
GIF (human) (recombinant)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-201-172-C050   50 µg 210.00 USD Add To Cart
Product Specification
SEQUENCE: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPA-ECEKCAKDCVCKGGEAAEAEAEKCSCCQ

C259H429N77O102S21Zn7
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Produced in E. coli.
CONCENTRATION: 140µg/ml
PURITY: ≥95% (SDS-PAGE). ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl containing 50mM NaCl and 1mM DTT.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-3 (MT-3). Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies. MT-3, also called neuronal growth inhibitor factor (GIF), was found to be deficient in Alzheimer's disease brains. It is to date the only MT for which biological activity is known.
Product Specific Literature References
The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein: Y. Uchida, et al.; Neuron 7, 337 (1991) Abstract
General Information
MT-3 is a single isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 68 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The primary structure shows a novel Cys(6)-Pro-Cys(8)-Pro motif and two inserts, a Thr at position 5 and an acidic hexapeptide at position 55, when compared to the classical MT-1/MT-2 sequences. The presence of the two novel and conserved Pro residues has been shown to be decisive for the biological activity of MT-3. MT-3 exhibits 70% sequence identity to the MT-1/MT-2 isoforms.

The 3D structure of MT-3 with seven divalent metal ions seems to contain two separate domains (alpha and beta) with metal-thiolate clusters similar to those found in MT-1 and MT-2. The MT-3 contains one redox labile zinc ion, which is proposed to have a certain impact to its biological function. In order to keep all 7 zinc ions bound; the product is supplied in the presence of 1mM DTT as a reducing reagent.

MT-3 is a non-inducible protein primarily confined to the brain. It impairs the survival and neurite formation of cultured neurons. MT-3 was found to be deficient in the brain of Alzheimer’s disease patients and therefore exhibits biological activity different from that of MT-1 and MT-2.

General Literature References
Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Advances in the structure and chemistry of metallothioneins: N. Romero-Isart & M. Vasak; J. Inorg. Biochem. 88, 388 (2002), (Review) Abstract
 
 
ALX-202-070 Revised 04-Dec-08
Metallothionein-1 (rabbit liver)
Add to Clipboard
SYNONYMS MT-1 (rabbit liver)
MT-I (rabbit liver)
MT-1A (rabbit liver)
Zn7-MT-1 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-070-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-1a and MT-2e and a minor portion of MT-2d. [1]
CONCENTRATION: 1380µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, ≤0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, containing 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-1. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-1 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-1 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent metal ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-1 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]

General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem. J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Natural ProteinsCell Death / Apoptosis / Autophagy Other Products
 
 
ALX-202-071 Revised 04-Dec-08
Metallothionein-2 (rabbit liver)
Add to Clipboard
SYNONYMS MT-2 (rabbit liver)
MT-II (rabbit liver)
MT-2A (rabbit liver)
Zn7-MT-2 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-071-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-2a and minor portions of MT-2b and MT-2c. [1]
CONCENTRATION: 780µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, ≤0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-2. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-2 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-2 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-2 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]

General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Natural ProteinsCell Death / Apoptosis / Autophagy Other Products
 
 
ALX-270-097 Revised 07-Sep-06
Ebselen
Add to Clipboard
SYNONYMS 2-Phenyl-1,2-benzisoselenazol-3-(2H)-one
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Peroxynitrite / Scavengers / Detection
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-270-097-M001   1 mg 12.00 USD Add To Cart
ALX-270-097-M005   5 mg 20.00 USD Add To Cart
ALX-270-097-M025   25 mg 60.00 USD Add To Cart
Product Specification
FORMULA: C13H9NOSe
MW: 274.2
CAS NUMBER: 60940-34-3
PURITY: ≥98% (NMR)
APPEARANCE: White to off-white crystalline solid.
SOLUBILITY: Soluble in DMSO.
SHIPPING: AMBIENT
LONG TERM STORAGE: -20°C
HANDLING: Protect from light.

Product Description
Selenium-based inhibitor of protein kinase C, NADPH, 5-lipoxygenase, cyclooxygenase (COX) and NADPH oxidase. Anti-inflammatory antioxidant. Mimics glutathione peroxidase. Inhibits oxidative modifications of low density lipoproteins (LDL).
Product Specific Literature References
A novel biologically active seleno-organic compound--III. Effects of PZ 51 (Ebselen) on glutathione peroxidase and secretory activities of mouse macrophages: M.J. Parnham & S. Kindt; Biochem. Pharmacol. 33, 3247 (1984) Abstract
Seleno-organic compounds and the therapy of hydroperoxide-linked pathological conditions: M.J. Parnham & E. Graf; Biochem. Pharmacol. 36, 3095 (1987) Abstract
Kinetic mechanism and substrate specificity of glutathione peroxidase activity of ebselen (PZ51): M. Maiorino, et al.; Biochem. Pharmacol. 37, 2267 (1988) Abstract
Studies on the anti-inflammatory activity of ebselen. Ebselen interferes with granulocyte oxidative burst by dual inhibition of NADPH oxidase and protein kinase C?: I.A. Cotgreave, et al.; Biochem. Pharmacol. 38, 649 (1989) Abstract
T. Nikawa, et al.; Biochem. Pharmacol. 47, 1007 (1994) Abstract
Effects of ebselen and probucol on oxidative modifications of lipid and protein of low density lipoprotein induced by free radicals: N. Noguchi, et al.; Biochim. Biophys. Acta 1213, 176 (1994) Abstract
Strong inhibition of mammalian lipoxygenases by the antiinflammatory seleno-organic compound ebselen in the absence of glutathione: C. Schewe, et al.; Biochem. Pharmacol. 48, 65 (1994) Abstract
Ebselen: a glutathione peroxidase mimic: H. Sies; Meth. Enzymol. 234, 476 (1994) Abstract
Molecular actions of ebselen-an antiinflammatory antioxidant: T. Schewe; Gen. Pharmacol. 26, 1153 (1995) Abstract
Ebselen: H. Sies; Meth. Enzymol. 252, 341 (1995) Abstract
Ebselen as a glutathione peroxidase mimic and as a scavenger of peroxynitrite: H. Sies & H. Masumoto; Adv. Pharmacol. 38, 229 (1997) Abstract
Free radical generation by selenium compounds and their prooxidant toxicity: J.E. Spallholz; Biomed. Environ. Sci. 10, 260 (1997) Abstract
Protection against peroxynitrite by selenoproteins: H. Sies, et al.; Z. Naturforsch. [C] 53, 228 (1998) Abstract
Ebselen protects mice against T cell-dependent, TNF-mediated apoptotic liver injury: G. Tiegs, et al.; J. Pharmacol. Exp. Ther. 287, 1098 (1998) Abstract; Full Text
 
 
ALX-270-262 Revised 13-Feb-08
Ellagic acid . dihydrate
Add to Clipboard
SYNONYMS 4,4',5,5',6,6'-Hexahydroxydiphenic acid 2,6,2',6'-dilactone . 2H2O
PRODUCT LINE Natural Products / Antibiotics
PRODUCT CATEGORY Natural Products - Antioxidants
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-270-262-M100   100 mg 12.00 USD Add To Cart
Product Specification
FORMULA: C14H6O8 . 2H2O
MW: 302.2 . 36.0
CAS NUMBER: 476-66-4
MERCK INDEX: 14: 3547
RTECS: DJ2620000
SOURCE/HOST: Isolated from chestnut bark.
PURITY: ≥97%
APPEARANCE: Grey to green solid.
SOLUBILITY: Soluble in 1M sodium hydroxide (10mg/ml) or pyridine.
SHIPPING: AMBIENT
LONG TERM STORAGE: +4°C
HANDLING: Keep under inert gas. Protect from light.
HAZARD: IRRITANT.
IDENTITY: Determined by MS and NMR.

Product Description
Polyphenol antioxidant with antitumor properties. Inhibitor of topoisomerases. Inhibits VEGF-induced phosphorylation of VEGFR-2 and PDGF-induced phosphorylation of PDGFR. Induces apoptosis.
Product Specific Literature References
The dietary anticancer agent ellagic acid is a potent inhibitor of DNA topoisomerases in vitro: A. Constantinou, et al.; Nutr. Cancer 23, 121 (1995) Abstract
Novel inhibitors of 3-phosphoglycerate kinase: M.J. Hickey, et al.; Biochem. Soc. Trans. 23, 607S (1995) Abstract
Inhibitory actions of ellagic acid on growth and arylamide N-acetyltransferase activity in strains of Heliobacter pylori from peptic ulcer patients: J.G. Chung; Microbios 93, 115 (1998) Abstract
Polyphenols inhibit promotional phase of tumorigenesis: relevance of superoxide radicals: A. Kaul & K.L. Khanduja; Nutr. Cancer 32, 81 (1998) Abstract
Inhibition of eukaryote serine/threonine-specific protein kinases by piceatannol: B.H. Wang, et al.; Planta Med. 64, 195 (1998) Abstract
p53/p21 (WAF1CIP1) expression and its possible role in G1 arrest and apoptosis in ellagic acid treated cancer cells: B.A. Narayanan, et al.; Cancer Lett. 136, 215 (1999) Abstract
Combined inhibition of PDGF and VEGF receptors by ellagic acid, a dietary-derived phenolic compound: L. Labrecque, et al.; Carcinogenesis 26, 821 (2005) Abstract
Antioxidant and apoptosis-inducing activities of ellagic acid: D.H. Han, et al.; Anticancer Res. 26, 3601 (2006) Abstract
The efficacy of protective effects of tannic acid, gallic acid, ellagic acid, and propyl gallate against hydrogen peroxide-induced oxidative stress and DNA damages in IMR-90 cells: C.H. Chen, et al.; Mol. Nutr. Food Res. 51, 962 (2007) Abstract
Ellagic acid, a natural polyphenol protects rat peripheral blood lymphocytes against nicotine-induced cellular and DNA damage in vitro: with the comparison of N-acetylcysteine: A.R. Sudheer, et al.; Toxicology 230, 11 (2007) Abstract
 
 
ALX-270-265 Revised 29-Jan-05
U-74389G
Add to Clipboard
SYNONYMS 21-(4-(2,6-di-1-Pyrrolidinyl-4-pyrimidinyl)-1-piperazinyl)-pregna-1,4,9(11)-triene-3,20-dione . (Z)-2-butenedioate
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Lipid Peroxidation
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-270-265-M010   10 mg 15.00 USD Add To Cart
ALX-270-265-M050   50 mg 63.00 USD Add To Cart
Product Specification
FORMULA: C37H50N6O2 . C4H4O4
MW: 610.8 . 116.1
CAS NUMBER: 153190-29-5
PURITY: ≥98%
APPEARANCE: Crystalline solid.
SOLUBILITY: Soluble in DMSO or 100% ethanol. Insoluble in water.
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
USE/STABILITY: Store solutions of U-74389G on ice and use within 6 hours of preparation. We strongly recommend using fresh solution for each experiment. 
HANDLING: Hygroscopic.

Product Description
Lazaroid inhibitor of iron-dependent lipid peroxidation. Antioxidant.
Product Specific Literature References
Hydrogen peroxide induces 21-aminosteroid-inhibitable F2-isoprostane production and cytolysis in renal tubular epithelial cells: A. Salahudeen, et al.; J. Am. Soc. Nephrol. 6, 1300 (1995) Abstract
21-aminosteroid and 2-(aminomethyl)chromans inhibition of arachidonic acid-induced lipid peroxidation and permeability enhancement in bovine brain microvessel endothelial cell monolayers: F. Shi, et al.; Free Radic. Biol. Med. 19, 349 (1995) Abstract
Protection of ischemic and reperfused rat myocardium by the nonglucocorticoid 21-aminosteroid U-74389G, a new inhibitor of lipid peroxidation: G.M. Campo, et al.; J. Pharmacol. Exp. Ther. 277, 333 (1996) Abstract
Protection of rat heart from ischaemia-reperfusion injury by the 21-aminosteroid U-74389G: A.M. Perna, et al.; Pharmacol. Res. 34, 25 (1996) Abstract
Comparison of various lazaroid compounds for protection against ischemic liver injury: N. Ishizaki, et al.; Transplantation 63, 202 (1997) Abstract
Protein oxidation biomarkers in hyperoxic lung injury in rats: effects of U-74389: S. Awasthi, et al.; Toxicol. Lett. 95, 47 (1998) Abstract
The 21-aminosteroid U-74389G reduces cerebral superoxide anion concentration following fluid percussion injury of the brain: R.H. Fabian, et al.; J. Neurotrauma 15, 433 (1998) Abstract
Novel 21-aminosteroid U-74389G inhibits low-density lipoprotein peroxidation induced by .OH and O2-. free radicals: A. Khalil, et al.; Life Sci. 63, 769 (1998) Abstract
Intrahippocampal injection of paraquat produces apoptotic cell death which is prevented by the lazaroid U74389G, in rats: D. Melchiorri, et al.; Life Sci. 62, 1927 (1998) Abstract
The lazaroid, U-74389G, inhibits inducible nitric oxide synthase activity, reverses vascular failure and protects against endotoxin shock:: D. Altavilla, et al.; Eur. J. Pharmacol. 369, 49 (1999) Abstract
Effect of lazaroid U-74389G and methylprednisolone on endotoxin-induced shock in mice: K. Fukuma, et al.; Surgery 125, 421 (1999) Abstract
Neuroprotective efficacy of combination therapy with two different antioxidants in rats subjected to transient focal ischemia: R. Schmid-Elsaesser, et al.; Brain Res. 816, 471 (1999) Abstract; Full Text