• Home
  • Sitemap
  • Help
  • Technical Support
  • Contact
Cell Death / Apoptosis / Autophagy Other Products
You are here: Product Lines > Cell Cycle > Cell Death / Apoptosis / Autophagy Other Products
Toolbar - View Selection
 
Items 12 of 12
ALX-804-034 Revised 23-Apr-08
Enhancer for Ligands
Add to Clipboard
PRODUCT LINE Cell Death / Apoptosis / Autophagy
PRODUCT CATEGORY Cell Death / Apoptosis / Autophagy Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-804-034-C050   50 µg 195.00 USD Add To Cart
Inquire
Product Specification
CONCENTRATION: 1mg/ml after reconstitution.
FORMULATION: Lyophilized. Contains PBS.
RECONSTITUTION: Reconstitute with 50µl sterile water.
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. After reconstitution, prepare aliquots and store at -20°C.
Product Specific Literature References
Two adjacent trimeric Fas ligands are required for Fas signaling and formation of a death-inducing signaling complex: N. Holler, et al.; Mol. Cell. Biol. 23, 1428 (2003) Abstract; Full Text
 
 
ALX-203-001 Revised 23-Apr-08
Enhancer for Receptors
Add to Clipboard
PRODUCT LINE Cell Death / Apoptosis / Autophagy
PRODUCT CATEGORY Cell Death / Apoptosis / Autophagy Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-203-001-C020   20 µg 190.00 USD Add To Cart
Inquire
Product Specification
CONCENTRATION: 1mg/ml after reconstitution.
APPEARANCE: Lyophilized. Contains PBS.
RECONSTITUTION: Reconstitute with 20µl sterile water.
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
HANDLING: After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Product Specific Literature References
Two adjacent trimeric Fas ligands are required for Fas signaling and formation of a death-inducing signaling complex: N. Holler, et al.; Mol. Cell. Biol. 23, 1428 (2003) Abstract; Full Text
 
 
ALX-202-070 Revised 04-Dec-08
Metallothionein-1 (rabbit liver)
Add to Clipboard
SYNONYMS MT-1 (rabbit liver)
MT-I (rabbit liver)
MT-1A (rabbit liver)
Zn7-MT-1 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-070-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-1a and MT-2e and a minor portion of MT-2d. [1]
CONCENTRATION: 1380µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, ≤0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, containing 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-1. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-1 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-1 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent metal ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-1 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]

General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem. J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Natural ProteinsCell Death / Apoptosis / Autophagy Other Products
 
 
ALX-202-071 Revised 04-Dec-08
Metallothionein-2 (rabbit liver)
Add to Clipboard
SYNONYMS MT-2 (rabbit liver)
MT-II (rabbit liver)
MT-2A (rabbit liver)
Zn7-MT-2 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-071-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-2a and minor portions of MT-2b and MT-2c. [1]
CONCENTRATION: 780µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, ≤0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-2. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-2 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-2 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-2 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]

General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Natural ProteinsCell Death / Apoptosis / Autophagy Other Products
 
 
ALX-201-172 Revised 10-Jun-05
Metallothionein-3 (human) (recombinant)
Add to Clipboard
SYNONYMS MT-3 (human) (recombinant)
Zn7-MT-3 (human) (recombinant)
Neuronal Growth Inhibitory Factor (human) (recombinant)
GIF (human) (recombinant)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-201-172-C050   50 µg 210.00 USD Add To Cart
Product Specification
SEQUENCE: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPA-ECEKCAKDCVCKGGEAAEAEAEKCSCCQ

C259H429N77O102S21Zn7
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Produced in E. coli.
CONCENTRATION: 140µg/ml
PURITY: ≥95% (SDS-PAGE). ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl containing 50mM NaCl and 1mM DTT.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-3 (MT-3). Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies. MT-3, also called neuronal growth inhibitor factor (GIF), was found to be deficient in Alzheimer's disease brains. It is to date the only MT for which biological activity is known.
Product Specific Literature References
The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein: Y. Uchida, et al.; Neuron 7, 337 (1991) Abstract
General Information
MT-3 is a single isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 68 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The primary structure shows a novel Cys(6)-Pro-Cys(8)-Pro motif and two inserts, a Thr at position 5 and an acidic hexapeptide at position 55, when compared to the classical MT-1/MT-2 sequences. The presence of the two novel and conserved Pro residues has been shown to be decisive for the biological activity of MT-3. MT-3 exhibits 70% sequence identity to the MT-1/MT-2 isoforms.

The 3D structure of MT-3 with seven divalent metal ions seems to contain two separate domains (alpha and beta) with metal-thiolate clusters similar to those found in MT-1 and MT-2. The MT-3 contains one redox labile zinc ion, which is proposed to have a certain impact to its biological function. In order to keep all 7 zinc ions bound; the product is supplied in the presence of 1mM DTT as a reducing reagent.

MT-3 is a non-inducible protein primarily confined to the brain. It impairs the survival and neurite formation of cultured neurons. MT-3 was found to be deficient in the brain of Alzheimer’s disease patients and therefore exhibits biological activity different from that of MT-1 and MT-2.

General Literature References
Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Advances in the structure and chemistry of metallothioneins: N. Romero-Isart & M. Vasak; J. Inorg. Biochem. 88, 388 (2002), (Review) Abstract
 
 
ALX-804-137 Revised 07-Dec-05
Monoclonal Antibody to A20 (human) (8E8.38)
Add to Clipboard
PRODUCT LINE Inflammation
PRODUCT CATEGORY TLRs Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-804-137-C050   50 µg 360.00 USD Add To Cart
Product Specification
SPECIES CROSSREACTIVITY:
Human
CLONE: 8E8.38
ISOTYPE: Mouse IgG1
FORMULATION: Liquid. In PBS containing 0.02% sodium azide.
IMMUNOGEN: Zinc finger domain corresponding to aa 375-537 of human A20.
SPECIFICITY: Recognizes human A20.
APPLICATION: Western Blot (1:1'000)
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
USE/STABILITY: Stable for at least 1 year after receipt when stored as recommended.
HANDLING: Avoid freeze/thaw cycles.
Product Images
Please click on thumbnails to enlarge.
Product Description
A20 is a zinc finger protein that renders cells resistant to apoptosis. A20-deficient mice develop severe inflammation and are hyper-responsive to LPS. S.M. O'Reilly & P.N. Moynagh have shown that full length A20 inhibits activation of NF-kB and AP-1 by TLR4 [1].  A20 associates with A20-binding inhibitor of NF-kB (ABIN)-1 and -2 [2-4], which interfere with NF-kB activation upstream of the IKK complex.
Product Specific Literature References
A20 inhibits NF-kappa B activation downstream of multiple Map3 kinases and interacts with the I kappa B signalosome: F.S. Zetoune, et al.; Cytokine 15, 282 (2001) Abstract
General Information
MANUFACTURER Manufactured by Apotech Corporation.
General Literature References
[1] Regulation of Toll-like receptor 4 signalling by A20 zinc finger protein: S.M. O'Reilly and P.N. Moynagh; Biochem. Biophys. Res. Commun. 3303, 586 (2003) Abstract
[2] The zinc finger protein A20 inhibits TNF-induced NF-kappaB-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal and directly binds to a novel NF-kappaB-inhibiting protein ABIN: K. Heyninck, et al.; J. Cell Biol. 145, 1471 (1999) Abstract; Full Text
[3] Identification of a novel A20-binding inhibitor of nuclear factor-kappa B activation termed ABIN-2: S. Van Huffel, et al.; J Biol Chem 276, 30216 (2001) Abstract; Full Text
[4] Structure-function analysis of the A20-binding inhibitor of NF-kappa B activation, ABIN-1: K. Heyninck, et al.; FEBS Lett. 536, 135 (2003) Abstract
 
 
ALX-804-601 Revised 20-Jun-08
Monoclonal Antibody to BAP31 (A1/182)
Add to Clipboard
SYNONYMS anti-BCR-associated Protein BAP31 MAb (A1/182)
anti-p28 BAP31 MAb (A1/182)
anti-CDM MAb (A1/182)
anti-DXS1357E MAb (A1/182)
anti-6C6-AG Tumor-associated Antigen MAb (A1/182)
PRODUCT LINE Immunology
PRODUCT CATEGORY B Cell Receptor [BCR] & Co-Receptors / Related Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-804-601-C100   100 µg 320.00 USD Add To Cart
Product Specification
SPECIES CROSSREACTIVITY:
Human
Monkey
CLONE: A1/182
ISOTYPE: Mouse IgG2a
CONCENTRATION: 1mg/ml after reconstitution.
FORMULATION: Lyophilized. Protein G-affinity purified and gel filtrated (FPLC).
RECONSTITUTION: Reconstitute with 100µl PBS containing 0.1% sodium azide.
IMMUNOGEN: BAP31 (BCR associated protein BAP031) from Vero monkey cells.
SPECIFICITY: Recognizes human and monkey BAP31.
APPLICATION: ELISA
Flow Cytometry
Immunocytochemistry (1:1’000)
Immunohistochemistry (frozen sections)
Immunoprecipitation (2µl)
Western Blot (1:1’000)
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles.
Product Images
Please click on thumbnails to enlarge.
Product Specific Literature References
The recycling pathway of protein ERGIC-53 and dynamics of the ER-Golgi intermediate compartment: J. Klumperman, et al.; J. Cell Sci. 111, 3411 (1998) Abstract; Full Text
A novel direct interaction of endoplasmic reticulum with microtubules: D.R. Klopfenstein, et al.; EMBO J. 17, 6168 (1998) Abstract; Full Text
Subdomain-specific localization of CLIMP-63 (p63) in the endoplasmic reticulum is mediated by its luminal alpha-helical segment: D.R. Klopfenstein, et al.; J. Cell Biol. 153, 1287 (2001) Abstract; Full Text
Proteomics of endoplasmic reticulum-golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46: L. Breuza, et al.; J. Biol. Chem. 279, 47242 (2004) Abstract; Full Text
Capturing protein interactions in the secretory pathway of living cells: B. Nyfeler, et al.; PNAS 102, 6350 (2005) Abstract; Full Text
The Cargo Receptors Surf4, Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC)-53, and p25 Are Required to Maintain the Architecture of ERGIC and Golgi: S. Mitrovic, et al.; Mol. Biol. Cell 19, 1976 (2008) Abstract
General Information
BAP31 (B cell receptor-associated protein 31) is an integral protein of the ER membrane that forms a large hetero-oligomeric complex with the related BAP29. The cytosolic domain of BAP31 contains two identical caspase recognition sites that are preferentially cleaved by initiator caspases, including caspase-8. After activation of cell surface death receptors, human BAP31 is cleaved into a membrane-embedded fragment called p20, which induces apoptosis when expressed ectopically. The p20 fragment can mediate Ca2+-dependent apoptotic cross-talk between the ER and mitochondria, stimulating cytochrome c release. In addition to its role in apoptosis, BAP31 is a component of the ER quality control compartment and functions as a cargo receptor for ER export of transmembrane proteins such as cellubrevin, MHC class I molecules, and cytochrome P450 2C2.
General Literature References
Caspase-resistant BAP31 inhibits fas-mediated apoptotic membrane fragmentation and release of cytochrome c from mitochondria: M. Nguyen, et al.; Mol. Cell. Biol. 20, 6731 (2000) Abstract; Full Text
Caspase cleavage product of BAP31 induces mitochondrial fission through endoplasmic reticulum calcium signals, enhancing cytochrome c release to the cytosol: D.G. Breckenridge, et al.; J. Cell. Biol. 160, 1115 (2003) Abstract; Full Text
Bap31 Is an Itinerant Protein that Moves between the Peripheral ER and a Juxtanuclear Compartment Related to ER-associated Degradation: Y. Wakana, et al.; Mol. Biol. Cell 19, 1825 (2008) Abstract; Full Text
 
 
ALX-804-812 Revised 20-Jun-08
Monoclonal Antibody to BAP31 (CC-1)
Add to Clipboard
SYNONYMS anti-B Cell Receptor-associated Protein BAP31 MAb (CC-1)
anti-BCR-associated Protein BAP31 MAb (CC-1)
anti-p28 BAP31 MAb (CC-1)
anti-CDM Protein MAb (CC-1)
anti-6C6-AG Tumor-associated Antigen MAb (CC-1)
anti-DXS1357E MAb (CC-1)
PRODUCT LINE Immunology
PRODUCT CATEGORY B Cell Receptor [BCR] & Co-Receptors / Related Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-804-812-C100   100 µg 320.00 USD Add To Cart
Product Specification
SPECIES CROSSREACTIVITY:
Human
Goat
Sheep
Monkey
Others
CLONE: CC-1
ISOTYPE: Rat IgG2a
SOURCE/HOST: Purified from concentrated hybridoma tissue culture supernatant.
CONCENTRATION: 0.5mg/ml
PURITY: >95% (SDS-PAGE)
FORMULATION: Liquid. Protein G affinity purified antibody in PBS containing 0.02% sodium azide.
IMMUNOGEN: Solubilized membranes of the IMR-32 human neuroblastoma cell line.
SPECIFICITY: Recognizes an epitope (aa 230-246) encompassing a caspase recognition site and the ER-homing motif (KKEE), present at the C-terminus of human, primate, bovine and hamster BAP31. Does not recognize mouse and rat BAP31.
APPLICATION: ELISA (capture)
Immunocytochemistry (1:1'000-1:10'000; works on endogenous)
Immunohistochemistry (frozen sections (1:1'000-1:10'000); works on endogenous)
Immunoprecipitation
Western Blot (1:1'000-1:6'000; works on endogenous).
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles.
Product Specific Literature References
Endoplasmic reticulum membrane-sorting protein of lymphocytes (BAP31) is highly expressed in neurons and discrete endocrine cells: H.A. Manley and V.A. Lennon; J. Histochem. Cytochem. 49, 1235 (2001) Abstract; Full Text
Association of BAP31 with CD11b/CD18. Potential role in intracellular trafficking of CD11b/CD18 in neutrophils: K. Zen, et al.; J. Biol. Chem. 279, 44924 (2004) Abstract; Full Text
Bap31 enhances the endoplasmic reticulum export and quality control of human class I MHC molecules: J.J. Ladasky, et al.; J. Immunol. 177, 6172 (2006) Abstract
General Information
BAP31 (B cell receptor-associated protein 31) is an integral protein of the ER membrane that forms a large hetero-oligomeric complex with the related BAP29. The cytosolic domain of BAP31 contains two identical caspase recognition sites that are preferentially cleaved by initiator caspases, including caspase-8. After activation of cell surface death receptors, human BAP31 is cleaved into a membrane-embedded fragment called p20, which induces apoptosis when expressed ectopically. The p20 fragment can mediate Ca2+-dependent apoptotic cross-talk between the ER and mitochondria, stimulating cytochrome c release. In addition to its role in apoptosis, BAP31 is a component of the ER quality control compartment and functions as a cargo receptor for ER export of transmembrane proteins such as cellubrevin, MHC class I molecules, and cytochrome P450 2C2.
MANUFACTURER Manufactured by Apotech Corporation.
General Literature References
Caspase-resistant BAP31 inhibits fas-mediated apoptotic membrane fragmentation and release of cytochrome c from mitochondria: M. Nguyen, et al.; Mol. Cell. Biol. 20, 6731 (2000) Abstract; Full Text
Caspase cleavage product of BAP31 induces mitochondrial fission through endoplasmic reticulum calcium signals, enhancing cytochrome c release to the cytosol: D.G. Breckenridge, et al.; J. Cell. Biol. 160, 1115 (2003) Abstract; Full Text
Bap31 Is an Itinerant Protein that Moves between the Peripheral ER and a Juxtanuclear Compartment Related to ER-associated Degradation: Y. Wakana, et al.; Mol. Biol. Cell 19, 1825 (2008) Abstract; Full Text
 
 
ALX-804-809 Revised 24-Mar-05
Monoclonal Antibody to MFG-E8 (mouse) (2422)