ALEXIS Biochemicals: Metallothionein-3 (human) (recombinant)

ALX-201-172

Revised 10-Jun-05

Metallothionein-3 (human) (recombinant)
SYNONYMS	MT-3 (human) (recombinant) Zn₇-MT-3 (human) (recombinant) Neuronal Growth Inhibitory Factor (human) (recombinant) GIF (human) (recombinant)
PRODUCT LINE	Oxidative Stress
PRODUCT CATEGORY	Antioxidants, Flavonoids & Free Radical Scavengers Other Products

Ordering Information

Product Numbers:	Format:	Size:	Unit Price:	Quantity:	Add To Cart
ALX-201-172-C050		50 µg	210.00 USD

Product Specification

SEQUENCE:	MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPA-ECEKCAKDCVCKGGEAAEAEAEKCSCCQ C₂₅₉H₄₂₉N₇₇O₁₀₂S₂₁Zn₇
MW:	6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST:	Produced in E. coli.
CONCENTRATION:	140µg/ml
PURITY:	≥95% (SDS-PAGE). ~7 Zn per molecule.
PURITY DETAIL:	Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION:	Liquid. In 25mM TRIS/HCl containing 50mM NaCl and 1mM DTT.
QUALITY CONTROL:	SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING:	SHIPPED ON BLUE ICE
SHORT TERM STORAGE:	+4°C
LONG TERM STORAGE:	-20°C
HANDLING:	Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.

Product Description

Non-toxic ready-to-use zinc-containing metallothionein-3 (MT-3). Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies. MT-3, also called neuronal growth inhibitor factor (GIF), was found to be deficient in Alzheimer's disease brains. It is to date the only MT for which biological activity is known.

Product Specific Literature References

The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein: Y. Uchida, et al.; Neuron 7, 337 (1991) Abstract

General Information

MT-3 is a single isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 68 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The primary structure shows a novel Cys(6)-Pro-Cys(8)-Pro motif and two inserts, a Thr at position 5 and an acidic hexapeptide at position 55, when compared to the classical MT-1/MT-2 sequences. The presence of the two novel and conserved Pro residues has been shown to be decisive for the biological activity of MT-3. MT-3 exhibits 70% sequence identity to the MT-1/MT-2 isoforms.

The 3D structure of MT-3 with seven divalent metal ions seems to contain two separate domains (alpha and beta) with metal-thiolate clusters similar to those found in MT-1 and MT-2. The MT-3 contains one redox labile zinc ion, which is proposed to have a certain impact to its biological function. In order to keep all 7 zinc ions bound; the product is supplied in the presence of 1mM DTT as a reducing reagent.

MT-3 is a non-inducible protein primarily confined to the brain. It impairs the survival and neurite formation of cultured neurons. MT-3 was found to be deficient in the brain of Alzheimer’s disease patients and therefore exhibits biological activity different from that of MT-1 and MT-2.

General Literature References

Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Advances in the structure and chemistry of metallothioneins: N. Romero-Isart & M. Vasak; J. Inorg. Biochem. 88, 388 (2002), (Review) Abstract

Further Categories Containing This Product:

Recombinant Proteins / Fusion Proteins • Cell Death / Apoptosis / Autophagy Other Products