• Home
  • Sitemap
  • Help
  • Technical Support
  • Contact
Antioxidants, Flavonoids & Free Radical Scavengers
You are here: Product Lines > Oxidative Stress > Antioxidants, Flavonoids & Free Radical Scavengers
Toolbar - View Selection
 
 Items 60-80 of 101 Page 4 of 6 Select Page: << 1 2 3 4 5 6  >>  
ALX-350-355 Revised 26-Mar-08
Lupeol
Add to Clipboard
SYNONYMS Fagarasterol
20(29)-Lupen-3β-ol
3β-Hydroxy-20(29)-lupene
PRODUCT LINE Natural Products / Antibiotics
PRODUCT CATEGORY Natural Products - Anti-inflammatory Agents
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-350-355-M010   10 mg 35.00 USD Add To Cart
ALX-350-355-M050   50 mg 105.00 USD Add To Cart
ALX-350-355-G001   1 g 990.00 USD Add To Cart
Product Specification
FORMULA: C30H50O
MW: 426.7
CAS NUMBER: 545-47-1
MERCK INDEX: 14: 5608
RTECS: OK5763000
SOURCE/HOST: Isolated from Lupinus polyphyllus.
PURITY: ≥98% (HPLC)
APPEARANCE: White to off-white solid.
SOLUBILITY: Soluble in ether or warm 100% ethanol; insoluble in water
SHIPPING: AMBIENT
LONG TERM STORAGE: -20°C

Product Description
Anti-inflammatory, antioxidant and antimutagenic compound. Shows preventive effects on DMBA induced DNA alkylation damage in mouse skin. Modulator of NF-κB and PI(3)K/Akt (protein kinase B; PKB) pathways. Induces Fas-mediated apoptosis via inhibition of Ras signalling. Inhibits tumor growth in mouse in vivo.
Product Specific Literature References
Anti-inflammatory activity of lupeol and lupeol linoleate in rats: T. Geetha & P. Varalakshmi; J. Ethnopharmacol. 76, 77 (2001) Abstract
Lupeol, a triterpene, inhibits early responses of tumor promotion induced by benzoyl peroxide in murine skin: M. Saleem, et al.; Pharmacol. Res. 43, 127 (2001) Abstract
Lupeol modulates NF-kappaB and PI3K/Akt pathways and inhibits skin cancer in CD-1 mice: M. Saleem, et al.; Oncogene 23, 5203 (2004) Abstract
Induction of antifertility with lupeol acetate in male albino rats: R.S. Gupta, et al.; Pharmacology 75, 57 (2005) Abstract
A novel dietary triterpene Lupeol induces fas-mediated apoptotic death of androgen-sensitive prostate cancer cells and inhibits tumor growth in a xenograft model: M. Saleem, et al.; Cancer Res. 65, 11203 (2005) Abstract; Full Text
Lupeol, a fruit and vegetable based triterpene, induces apoptotic death of human pancreatic adenocarcinoma cells via inhibition of Ras signaling pathway: M. Saleem, et al.; Carcinogenesis 26, 1956 (2005) Abstract; Full Text
Lupeol long-chain fatty acid esters with antimalarial activity from Holarrhena floribunda: J. Fotie, et al.; J. Nat. Prod. 69, 62 (2006) Abstract
Lupeol ameliorates aflatoxin B1-induced peroxidative hepatic damage in rats: S.P. Preetha, et al.; Comp. Biochem. Physiol C. Toxicol. Pharmacol. 143, 333 (2006) Abstract
Role of lupeol and lupeol linoleate on lipemic-oxidative stress in experimental hypercholesterolemia: V. Sudhahar, et al.; Life Sci. 78, 1329 (2006) Abstract
Preventive effects of lupeol on DMBA induced DNA alkylation damage in mouse skin: N. Nigam, et al.; Food Chem. Toxicol. 45, 2331 (2007) Abstract
Lupeol suppresses cisplatin-induced nuclear factor-kappaB activation in head and neck squamous cell carcinoma and inhibits local invasion and nodal metastasis in an orthotopic nude mouse model: T.K. Lee, et al.; Cancer Res. 67, 8800 (2007) Abstract
 
 
ALX-385-007 Revised 07-Apr-08
Luteolin
Add to Clipboard
SYNONYMS 3',4',5,7-Tetrahydroxyflavone
PRODUCT LINE Natural Products / Antibiotics
PRODUCT CATEGORY Flavonoids/Related Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-385-007-M010   10 mg 15.00 USD Add To Cart
ALX-385-007-M050   50 mg 45.00 USD Add To Cart
Product Specification
FORMULA: C15H10O6
MW: 286.2
CAS NUMBER: 491-70-3
MERCK INDEX: 14: 5614
RTECS: LK9275210
PURITY: ≥90%
APPEARANCE: Yellow powder.
SOLUBILITY: Soluble in methanol, alkaline solutions; slightly soluble in water.
SHIPPING: AMBIENT
LONG TERM STORAGE: +20°C

Product Description
Antioxidant flavonoid. Inhibits VEGF-induced angiogenesis. Inhibitor of the catalytic activity of phosphoinositide 3-kinase (PI(3)K), whereas inhibition of PI(3)K by luteolin affects apoptosis via PI(3)K/Akt (protein kinase B; PKB) pathways and antimitotic effects via PI(3)K/p70S6K pathways. Inhibitor of fatty acid synthase (FAS). Apoptosis inducer.
Product Specific Literature References
Structure-antioxidant activity relationships of flavonoids and phenolic acids: C.A. Rice-Evans, et al.; Free Radical Biol. & Med. 20, 933 (1996), (Review) Abstract
Luteolin inhibits vascular endothelial growth factor-induced angiogenesis; inhibition of endothelial cell survival and proliferation by targeting phosphatidylinositol 3'-kinase activity: E. Bagli, et al.; Cancer Res. 64, 7936 (2004)
Dietary flavonoids: bioavailability, metabolic effects, and safety: J.A. Ross & C.M. Kasum; Annu. Rev. Nutr. 221, 19 (2002), (Review) Abstract
Pharmacological inhibitors of Fatty Acid Synthase (FASN)--catalyzed endogenous fatty acid biogenesis: a new family of anti-cancer agents?: R. Lupu & J. A. Menendez; Curr. Pharm. Biotechnol. 7, 483 (2006), (Review) Abstract
 
 
ALX-385-013 Revised 16-Jun-08
Malvidin chloride
Add to Clipboard
SYNONYMS 3,4',5,7-Tetrahydroxy-3',5'-dimethoxyflavylium chloride
PRODUCT LINE Natural Products / Antibiotics
PRODUCT CATEGORY Flavonoids/Related Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-385-013-M010   10 mg 260.00 USD Add To Cart
Product Specification
FORMULA: C17H15O7Cl
MW: 366.8
CAS NUMBER: 643-84-5
MERCK INDEX: 14: 5715
RTECS: LK9900000
PURITY: ≥97%
APPEARANCE: Reddish brown to black powder.
SOLUBILITY: Soluble in 100% ethanol; slightly soluble in water.
SHIPPING: AMBIENT
LONG TERM STORAGE: +4°C
HANDLING: Protect from light. Hygroscopic.

Product Description
Antioxidant flavonoid. Antitumor compound. Induces cell cycle arrest in the G2/M-phase.
Product Specific Literature References
Structure-antioxidant activity relationships of flavonoids and phenolic acids: C.A. Rice-Evans, et al.; Free Radical Biol. & Med. 20, 933 (1996), (Review) Abstract
Biological activities of malvidin, a red wine anthocyanidin: J. Fritz, et al.; Mol. Nutr. Food Res. 50, 390 (2006) Abstract
 
 
ALX-202-070 Revised 10-Jun-05
Metallothionein-1 (rabbit liver)
Add to Clipboard
SYNONYMS MT-1 (rabbit liver)
MT-I (rabbit liver)
MT-1A (rabbit liver)
Zn7-MT-1 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-070-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-1a and MT-2e and a minor portion of MT-2d. [1]
CONCENTRATION: 590µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, containing 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-1. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-1 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-1 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent metal ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-1 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]

General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem. J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Cell Death / Apoptosis / Autophagy Other ProductsNatural Proteins
 
 
ALX-202-071 Revised 10-Jun-05
Metallothionein-2 (rabbit liver)
Add to Clipboard
SYNONYMS MT-2 (rabbit liver)
MT-II (rabbit liver)
MT-2A (rabbit liver)
Zn7-MT-2 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-071-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-2a and minor portions of MT-2b and MT-2c. [1]
CONCENTRATION: 638µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: After opening, prepare aliquots and store at -20°C. For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-2. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-2 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-2 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-2 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]

General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Cell Death / Apoptosis / Autophagy Other ProductsNatural Proteins
 
 
ALX-201-172 Revised 10-Jun-05
Metallothionein-3 (human) (recombinant)
Add to Clipboard
SYNONYMS MT-3 (human) (recombinant)
Zn7-MT-3 (human) (recombinant)
Neuronal Growth Inhibitory Factor (human) (recombinant)
GIF (human) (recombinant)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-201-172-C050   50 µg 210.00 USD Add To Cart
Product Specification
SEQUENCE: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPA-ECEKCAKDCVCKGGEAAEAEAEKCSCCQ

C259H429N77O102S21Zn7
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Produced in E. coli.
CONCENTRATION: 140µg/ml
PURITY: ≥95% (SDS-PAGE). ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl containing 50mM NaCl and 1mM DTT.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-3 (MT-3). Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies. MT-3, also called neuronal growth inhibitor factor (GIF), was found to be deficient in Alzheimer's disease brains. It is to date the only MT for which biological activity is known.
Product Specific Literature References
The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein: Y. Uchida, et al.; Neuron 7, 337 (1991) Abstract
General Information
MT-3 is a single isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 68 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The primary structure shows a novel Cys(6)-Pro-Cys(8)-Pro motif and two inserts, a Thr at position 5 and an acidic hexapeptide at position 55, when compared to the classical MT-1/MT-2 sequences. The presence of the two novel and conserved Pro residues has been shown to be decisive for the biological activity of MT-3. MT-3 exhibits 70% sequence identity to the MT-1/MT-2 isoforms.

The 3D structure of MT-3 with seven divalent metal ions seems to contain two separate domains (alpha and beta) with metal-thiolate clusters similar to those found in MT-1 and MT-2. The MT-3 contains one redox labile zinc ion, which is proposed to have a certain impact to its biological function. In order to keep all 7 zinc ions bound; the product is supplied in the presence of 1mM DTT as a reducing reagent.

MT-3 is a non-inducible protein primarily confined to the brain. It impairs the survival and neurite formation of cultured neurons. MT-3 was found to be deficient in the brain of Alzheimer’s disease patients and therefore exhibits biological activity different from that of MT-1 and MT-2.

General Literature References
Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Advances in the structure and chemistry of metallothioneins: N. Romero-Isart & M. Vasak; J. Inorg. Biochem. 88, 388 (2002), (Review) Abstract
 
 
ALX-430-069 Revised 25-Jan-08
MnTBAP chloride
Add to Clipboard
SYNONYMS Manganese (III) tetrakis (4-benzoic acid)porphyrin chloride
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Porphyrins
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-430-069-M010   10 mg 20.00 USD Add To Cart
ALX-430-069-M050   50 mg 60.00 USD Add To Cart
Product Specification
FORMULA: C48H28MnN4O8Cl
MW: 879.2
PURITY: ≥97%
APPEARANCE: Black crystalline powder.
SOLUBILITY: Dissolve at 0.1M in aqueous base, then buffer to pH 7.0 or higher as needed.
SHIPPING: AMBIENT
LONG TERM STORAGE: +4°C
HANDLING: Protect from light and moisture.

Product Description
Cell permeable SOD mimetic. Potent inhibitor of peroxynitrite-induced oxidative reactions (peroxynitrite scavenger), but not a scavenger of nitric oxide (NO).
Product Specific Literature References
Stable Mn(III) porphyrins mimic superoxide dismutase in vitro and substitute for it in vivo: K.M. Faulkner, et al.; J. Biol. Chem. 269, 23471 (1994) Abstract; Full Text
A metalloporphyrin superoxide dismutase mimetic protects against paraquat-induced endothelial cell injury, in vitro: B.J. Day, et al.; J. Pharm. Exp. Ther. 275, 1227 (1995) Abstract
Evaluation of the relative contribution of nitric oxide and peroxynitrite to the suppression of mitochondrial respiration in immunostimulated macrophages using a manganese mesoporphyrin superoxide dismutase mimetic and peroxynitrite scavenger: C. Szabó, et al.; FEBS Lett. 381, 82 (1996) Abstract
Mitochondrial nitric-oxide synthase stimulation causes cytochrome c release from isolated mitochondria. Evidence for intramitochondrial peroxynitrite formation: P. Ghafourifar, et al.; J. Biol. Chem. 274, 31185 (1999) Abstract; Full Text
Reactive oxygen species regulate activation-induced T cell apoptosis:: D.A. Hildeman, et al.; Immunity 10, 735 (1999) Abstract
Doxorubicin-induced apoptosis in endothelial cells and cardiomyocytes is ameliorated by nitrone spin traps and ebselen.: S. Kotamraju, et al.; J. Biol. Chem. 275, 33585 (2000) Abstract; Full Text
Endothelial heme oxygenase-1 induction by hypoxia. Modulation by inducible nitric-oxide synthase and S-nitrosothiols: R. Motterlini, et al.; J. Biol. Chem. 275, 13613 (2000) Abstract; Full Text
Mitochondrial membrane permeabilization and superoxide production during apoptosis. A single-cell analysis: H. Dussmann, et al.; J. Biol. Chem. 278, 12645 (2003) Abstract; Full Text
 
 
ALX-430-070 Revised 05-Mar-08
MnTMPyP . pentachloride
Add to Clipboard
SYNONYMS Manganese (III) tetrakis (1-methyl-4-pyridyl)porphyrin . 5Cl-
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Porphyrins
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-430-070-M010   10 mg 20.00 USD Add To Cart
ALX-430-070-M050   50 mg 50.00 USD Add To Cart
Inquire
Product Specification
FORMULA: C44H36MnN8Cl5
MW: 909.0
PURITY: ≥95%
APPEARANCE: Black crystalline powder.
SOLUBILITY: Soluble in water or aqueous buffers (e.g. 0.1M TRIS-HCl, pH 9.0 containing 1mM EDTA (>50mg/ml) or PBS, pH 7.2 (4mg/ml)).
SHIPPING: AMBIENT
LONG TERM STORAGE: -20°C
USE/STABILITY:

Prepare solutions immediately before experiments. We recommend using fresh preparations each day.


Product Description
Cell permeable SOD mimetic. Catalyzes the dismutation of O2- even in the presence of excess EDTA.
Product Specific Literature References
Stable Mn(III) porphyrins mimic superoxide dismutase in vitro and substitute for it in vivo: K.M. Faulkner, et al.; J. Biol. Chem. 269, 23471 (1994) Abstract; Full Text
A cationic manganic porphyrin inhibits uptake of paraquat by Escherichia coli: S.I. Liochev & I. Fridovich; Arch. Biochem. Biophys. 321, 271 (1995) Abstract
Superoxide scavenging by Mn(II/III) tetrakis (1-methyl-4-pyridyl) porphyrin in mammalian cells: P.R. Gardner, et al.; Arch. Biochem. Biophys. 325, 20 (1996) Abstract
The ortho effect makes manganese(III) meso-tetrakis(N-methylpyridinium- 2-yl)porphyrin a powerful and potentially useful superoxide dismutase mimic: Batinic-Haberle, et al.; J. Biol. Chem. 273, 24521 (1998) Abstract; Full Text
Molecular actions of a Mn(III)Porphyrin superoxide dismutase mimetic and peroxynitrite scavenger: reaction with nitric oxide and direct inhibition of NO synthase and soluble guanylyl cyclase: S. Pfeiffer, et al.; Mol. Pharmacol. 53, 795 (1998) Abstract
SODs are involved in the regulation of ICAM-1 expression in human melanoma and endothelial cells: R. Morandini, et al.; Cell. Mol. Biol. (Noisy-le-grand) 45, 1053 (1999) Abstract
Effects of superoxide dismutase mimetics on the activity of nitric oxide in rat aorta: A. MacKenzie, et al.; Br. J. Pharmacol. 127, 1159 (1999) Abstract
Inducible nitric oxide synthase-derived superoxide contributes to hypereactivity in small mesenteric arteries from a rat model of chronic heart failure: A.A. Miller, et al.; Br. J. Pharmacol. 131, 29 (2000) Abstract