• Home
  • Sitemap
  • Help
  • Technical Support
  • Contact
Oxidative Stress
You are here: Product Lines > Oxidative Stress
 
Toolbar - View Selection
 
 Items 150-200 of 337 Page 4 of 7 Select Page: << 1 2 3 4 5 6 7  >>  
ALX-270-252 Revised 03-Mar-05
MEG . sodium succinate
Add to Clipboard
SYNONYMS Mercaptoethylguanidine . sodium succinate
PRODUCT LINE Nitric Oxide Pathway
PRODUCT CATEGORY NOS Inhibitors (NOS Induction & Enzyme Activity)
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-270-252-M010   10 mg 95.00 USD Add To Cart
Product Specification
FORMULA: C3H10N3S . C4H4O4Na
MW: 120.2 . 139.1
PURITY: ≥90%
APPEARANCE: White solid.
SOLUBILITY: Soluble in water.
SHIPPING: SHIPPED ON BLUE ICE
LONG TERM STORAGE: -20°C
HANDLING: Keep under inert gas. Keep cool and dry. Protect from moisture.

Product Description
Inhibitor of inducible nitric oxide synthase (iNOS; NOS II). Peroxynitrite scavenger.
Product Specific Literature References
Spontaneous rearrangement of aminoalkylisothioureas into mercaptoalkylguanidines, a novel class of nitric oxide synthase inhibitors with selectivity towards the inducible isoform: G.J. Southan, et al.; Br. J. Pharmacol. 117, 619 (1996) Abstract
The inhibitory effects of mercaptoalkylguanidines on cyclo-oxygenase activity: B. Zingarelli, et al.; Br. J. Pharmacol. 120, 357 (1997) Abstract
Mercaptoethylguanidine and guanidine inhibitors of nitric-oxide synthase react with peroxynitrite and protect against peroxynitrite-induced oxidative damage: C. Szabó, et al.; J. Biol. Chem. 272, 9030 (1997) Abstract; Full Text
Antiinflammatory effects of mercaptoethylguanidine, a combined inhibitor of nitric oxide synthase and peroxynitrite scavenger, in carrageenan-induced models of inflammation: S. Cuzzocrea, et al.; Free Radic. Biol. Med. 24, 450 (1998) Abstract
Protective effects of MEG, a selective inhibitor of inducible nitric oxide synthase, in ligature-induced periodontitis in the rat [published erratum appears in Br. J. Pharmacol. 123, 741 (1998)]: Z. Lohinai, et al.; Br. J. Pharmacol. 123, 353 (1998) Abstract
Mercaptoethylguanidine, a combined inhibitor of nitric oxide synthase and peroxynitrite scavenger, reduces trinitrobenzene sulfonic acid-induced colonic damage in rats: B. Zingarelli, et al.; J. Pharmacol. Exp. Ther. 287, 1048 (1998) Abstract
Modulation of peroxynitrite- and hypochlorous acid-induced inactivation of alpha1-antiproteinase by mercaptoethylguanidine: M. Whiteman, et al.; Br. J. Pharmacol. 126, 1646 (1999) Abstract
Further Categories Containing This Product:
Peroxynitrite / Scavengers / Detection
 
 
ALX-460-007 Revised 02-Feb-07
Menadione
Add to Clipboard
SYNONYMS Vitamin K3
2-Methyl-1,4-naphthoquinone
PRODUCT LINE Natural Products / Antibiotics
PRODUCT CATEGORY Vitamins
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-460-007-G010   10 g 10.00 USD Add To Cart
Product Specification
FORMULA: C11H8O2
MW: 172.2
CAS NUMBER: 58-27-5
MERCK INDEX: 14: 5831
RTECS: QL9100000
PURITY: ≥98% (HPLC)
APPEARANCE: Yellow crystals.
SOLUBILITY: Soluble in 96% ethanol (16mg/ml) or DMSO (1mg/ml); almost insoluble in water.
SHIPPING: AMBIENT
LONG TERM STORAGE: +20°C
HANDLING: Protect from light.
HAZARD: HARMFUL.

Product Description
Cytotoxic in various cell lines. Induces apoptosis via elevation of peroxide and superoxide radical levels. Affects gap-junctional intercellular communication by mediation of tyrosine phosphorylation.
Product Specific Literature References
Vitamin K3 induces cell cycle arrest and cell death by inhibiting Cdc25 phosphatase: F.Y. Wu and T.P.; Eur. J. Cancer 35, 1388 (1999) Abstract
Apoptosis-inducing activity of vitamin C and vitamin K: H. Sakagami, et al.; Cell Mol. Biol. 46, 129 (2000) Abstract
Cytotoxic effect through fas/APO-1 expression due to vitamin K in human glioma cells: L.K. Sun, et al.; J. Neurooncol. 47, 31 (2000) Abstract
Cytotoxic activity of vitamins K1, K2 and K3 against human oral tumor cell lines: H. Okayasu, et al.; Anticancer Res. 21, 2387 (2001) Abstract
2-Methyl-1,4-naphthoquinone, vitamin K(3), decreases gap-junctional intercellular communication via activation of the epidermal growth factor receptor/extracellular signal-regulated kinase cascade: L.O. Klotz, et al.; Cancer Res. 62, 4922 (2002) Abstract; Full Text
Menadione metabolism to thiodione in hepatoblastoma by scanning electrochemical microscopy: J. Mauzeroll, et al.; PNAS 101, 17582 (2004) Abstract; Full Text
Menadione-induced reactive oxygen species generation via redox cycling promotes apoptosis of murine pancreatic acinar cells: D.N. Criddle, et al.; J. Biol. Chem. 281, 40485 (2006) Abstract; Full Text
Further Categories Containing This Product:
Antitumor Agents (DNA Interaction & Gene Regulation) • Antitumor Agents (Apoptosis Inducers) • Cell Stress, Oxidative Stress & Redox Signalling Other Products
 
 
ALX-202-070 Revised 10-Jun-05
Metallothionein-1 (rabbit liver)
Add to Clipboard
SYNONYMS MT-1 (rabbit liver)
MT-I (rabbit liver)
MT-1A (rabbit liver)
Zn7-MT-1 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-070-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-1a and MT-2e and a minor portion of MT-2d. [1]
CONCENTRATION: 590µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, containing 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-1. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-1 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-1 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent metal ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-1 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]
General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem. J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Natural Proteins • Cell Death / Apoptosis / Autophagy Other Products
 
 
ALX-202-071 Revised 10-Jun-05
Metallothionein-2 (rabbit liver)
Add to Clipboard
SYNONYMS MT-2 (rabbit liver)
MT-II (rabbit liver)
MT-2A (rabbit liver)
Zn7-MT-2 (rabbit liver)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-202-071-C500   500 µg 195.00 USD Add To Cart
Product Specification
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Isolated from rabbit liver. Mixture of MT isoforms. Contains mainly MT-2a and minor portions of MT-2b and MT-2c. [1]
CONCENTRATION: 638µg/ml
PURITY: ≥95%. ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl, pH 8.0, 50mM NaCl.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: After opening, prepare aliquots and store at -20°C. For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-2. Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies.
Product Specific Literature References
Large-scale preparation of metallothionein: biological sources: M. Vasak; Methods Enzymol. 205, 39 (1991) Abstract
Standard isolation procedure for metallothionein: M. Vasak; Meth. Enzymol. 205, 41 (1991) Abstract
General Information
MT-2 is an isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 61 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The MT-2 fraction contains additional MT isoforms, which differ only in amino acid residues other than Cys. They are similar in sequence and therefore also in charge.

The 3D structure of the metal complex contains two separate domains, alpha and beta. The alpha-domain encloses four bivalent metal ions in the form of a Me4Cys11 cluster. The beta-domain contains an analogous Me3Cys9 cluster. Monovalent ions like Cu(I) can form a cluster as well, via thiolate bonds. Much of our understanding of the biological actions of MTs has arisen from the comparative analysis of the chemical and structural features.

MT-2 is expressed in almost all tissues. It is a cytosolic protein, which is up-regulated in response to many factors, including metals, hormones, inflammation related stimuli (cytokines), and stressful reagents. It is suggested that it has multiple biological roles such as, regulatory role of Zn-metabolism (zinc-finger transcription factors), regulation of metal-exchange detoxification (marker for heavy metal intoxication), protection against reactive oxygen species (ROS), adaptation to stress, anti-apoptotic effects (activation of NF-κB/interaction with p50 subunit), and in protection against anticancer treatments. [2, 3]
General Literature References
[1] Primary structures of seven metallothioneins from rabbit tissue: P.E. Hunziker, et al.; Biochem J. 306, 265 (1995) Abstract
[2] Nuclear localization of metallothionein during cell proliferation and differentiation: M.G. Cherian & M.D. Apostolova; Cell. Mol. Biol. 46, 347 (2000), (Review) Abstract
[3] Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Further Categories Containing This Product:
Natural Proteins • Cell Death / Apoptosis / Autophagy Other Products
 
 
ALX-201-172 Revised 10-Jun-05
Metallothionein-3 (human) (recombinant)
Add to Clipboard
SYNONYMS MT-3 (human) (recombinant)
Zn7-MT-3 (human) (recombinant)
Neuronal Growth Inhibitory Factor (human) (recombinant)
GIF (human) (recombinant)
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Antioxidants, Flavonoids & Free Radical Scavengers Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-201-172-C050   50 µg 210.00 USD Add To Cart
Product Specification
SEQUENCE: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPA-ECEKCAKDCVCKGGEAAEAEAEKCSCCQ

C259H429N77O102S21Zn7
MW: 6145 (without Zn); 6603 (incl. 7 Zn).
SOURCE/HOST: Produced in E. coli.
CONCENTRATION: 140µg/ml
PURITY: ≥95% (SDS-PAGE). ~7 Zn per molecule.
PURITY DETAIL: Essentially free of cadmium and copper (Cd in traces, <0.2 Cu/molecule).
FORMULATION: Liquid. In 25mM TRIS/HCl containing 50mM NaCl and 1mM DTT.
QUALITY CONTROL: SDS-PAGE, Cu/Cd/Zn-AAS, UV/VIS
SHIPPING: SHIPPED ON BLUE ICE
SHORT TERM STORAGE: +4°C
LONG TERM STORAGE: -20°C
HANDLING: Avoid freeze/thaw cycles. For maximum product recovery after thawing, centrifuge the vial before opening the cap. After opening, prepare aliquots and store at -20°C.
Product Description
Non-toxic ready-to-use zinc-containing metallothionein-3 (MT-3). Cadmium ions, which are present due to the protein production in animals, were removed quantitatively and replaced by the natively occurring zinc ions (only traces of Cd, Cu remain). Suited for life science research including cell culture studies. MT-3, also called neuronal growth inhibitor factor (GIF), was found to be deficient in Alzheimer's disease brains. It is to date the only MT for which biological activity is known.
Product Specific Literature References
The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein: Y. Uchida, et al.; Neuron 7, 337 (1991) Abstract
General Information
MT-3 is a single isoform of the ubiquitously occurring metalloproteins characterized by a high metal and cysteine sulphur content. It is composed of a single polypeptide chain of 68 amino acids, 20 of which are cysteine residues and none of which are aromatic amino acids or histidine. The primary structure shows a novel Cys(6)-Pro-Cys(8)-Pro motif and two inserts, a Thr at position 5 and an acidic hexapeptide at position 55, when compared to the classical MT-1/MT-2 sequences. The presence of the two novel and conserved Pro residues has been shown to be decisive for the biological activity of MT-3. MT-3 exhibits 70% sequence identity to the MT-1/MT-2 isoforms.

The 3D structure of MT-3 with seven divalent metal ions seems to contain two separate domains (alpha and beta) with metal-thiolate clusters similar to those found in MT-1 and MT-2. The MT-3 contains one redox labile zinc ion, which is proposed to have a certain impact to its biological function. In order to keep all 7 zinc ions bound; the product is supplied in the presence of 1mM DTT as a reducing reagent.

MT-3 is a non-inducible protein primarily confined to the brain. It impairs the survival and neurite formation of cultured neurons. MT-3 was found to be deficient in the brain of Alzheimer’s disease patients and therefore exhibits biological activity different from that of MT-1 and MT-2.
General Literature References
Roles of the metallothionein family of proteins in the central nervous system: J. Hidalgo, et al.; Brain Res. Bull. 55, 133 (2001), (Review) Abstract
Advances in the structure and chemistry of metallothioneins: N. Romero-Isart & M. Vasak; J. Inorg. Biochem. 88, 388 (2002), (Review) Abstract
Further Categories Containing This Product:
Recombinant Proteins / Fusion Proteins • Cell Death / Apoptosis / Autophagy Other Products
 
 
ALX-340-062 Revised 18-Feb-08
Methyl Phytoprostane B1 (Type I) (racemic)
Add to Clipboard
SYNONYMS Methyl-8-(2-((E)-3-hydroxypent-1-enyl)-5-oxocyclopent-1-enyl)octanoate (racemic)
PRODUCT LINE Inflammation
PRODUCT CATEGORY Eicosanoids Other Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-340-062-M005   5 mg 390.00 USD Add To Cart
Product Specification
FORMULA: C19H30O4
MW: 322.5
SOURCE/HOST: Synthetic.
PURITY: ≥95% (13C-NMR)
APPEARANCE: Colourless liquid.
SOLUBILITY: Soluble in 100% ethanol, methanol, ether, ethyl acetate or halogenic solvents.
SHIPPING: AMBIENT
LONG TERM STORAGE: +4°C
HANDLING: Protect from light and moisture.
HAZARD: IRRITANT.
IDENTITY: Determined by 1H-NMR, 13C-NMR and MS.

Product Description
Prostaglandin/jasmonate-like product of nonenzymatic lipid peroxidation. Occurs ubiquitously in healty plants and increases in response to oxidative stress. Could potentially be used as a marker of oxidative degradation of plant derived food. Powerful inducer of glutathione-S-transferase, jasmonic acid and other stress related responses. The role of phytoprostanes in human nutrition is not clarified yet, but they are associated with inhibition of dendritic cell interleukin-12 production and augmentation of TH2 cell polarization.
Product Specific Literature References
The isoprostanoid pathway in plants: I. Thoma, et al.; Chem. Phys. Lipids 128, 135 (2004) Abstract
B1-phytoprostanes trigger plant defense and detoxification responses: C. Loeffler, et al.; Plant Physiol. 137, 328 (2005) Abstract
A flexible synthesis of the phytoprostanes B1 type I and II: S. El Fangour, et al.; J. Org. Chem. 70, 989 (2005) Abstract
Pollen-associated phytoprostanes inhibit dendritic cell interleukin-12 production and augment T helper type 2 cell polarization: C. Traidl-Hoffmann, et al.; J. Exp. Med. 201, 627 (2005) Abstract; Full Text
Further Categories Containing This Product:
Plant Research Reagents / Related Products • Oxidative Stress Markers & Reagents / Related Products
 
 
ALX-610-003 Revised 20-Jun-08
Methylene blue . trihydrate
Add to Clipboard
SYNONYMS 3,7-bis(Dimethylamino)phenothiazin-5-ium chloride . 3H2O
PRODUCT LINE Nitric Oxide Pathway
PRODUCT CATEGORY Nitric Oxide & NOS Detection / Related Products
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-610-003-G005   5 g 20.00 USD Add To Cart
Product Specification
FORMULA: C16H18ClN3S . 3H2O
MW: 319.9 . 54.1
CAS NUMBER: 7220-79-3
MERCK INDEX: 14: 6060
RTECS: SP5740000
APPEARANCE: Green crystalline powder.
SOLUBILITY: Soluble in water.
SHIPPING: AMBIENT
LONG TERM STORAGE: +20°C
HAZARD: HARMFUL. POTENT NEUROTOXIN.

Product Description
Inhibitor of soluble guanylyl cyclase (sGC). Biological staining agent. Spin-trap which forms stable adducts with oxygen free radicals in solution.
Product Specific Literature References
Novel actions of methylene blue: B. Mayer, et al.; Eur. Heart J 14 Suppl I, 22 (1993) Abstract
Inhibition of nitric oxide synthesis by methylene blue: B. Mayer, et al.; Biochem. Pharmacol. 45, 367 (1993) Abstract
Modulation of nitric oxide-dependent relaxation of pig tracheal smooth muscle by inhibitors of guanylyl cyclase and calcium activated potassium channels: M.S. Kannan & D.E. Johnson; Life Sci. 56, 2229 (1995) Abstract
Methylene blue induces cytotoxicity in human brain tumor cells: Y.S. Lee & R.D. Wurster; Cancer Lett. 88, 141 (1995) Abstract
Methylene blue is a muscarinic antagonist in cardiac myocytes: N. Abi-Gerges, et al.; Mol. Pharmacol. 52, 482 (1997) Abstract
A comparative study of the effects of three guanylyl cyclase inhibitors on the L-type Ca2+ and muscarinic K+ currents in frog cardiac myocytes: N. Abi-Gerges, et al.; Br. J. Pharmacol 121, 1369 (1997) Abstract
Methylene blue inhibits stimulatory effect of sodium nitroprusside but not of 3-morpholino sydnonimine on prolactin secretion in freely moving male rats: M.C. González & E. Llorente; Brain Res. Bull. 46, 229 (1998) Abstract
Comparison between endothelial and neuronal nitric oxide pathways in rat aorta and gastric fundus: C. Guilmard, et al.; Nitric Oxide 2, 147 (1998) Abstract
Comparison of two soluble guanylyl cyclase inhibitors, methylene blue and ODQ, on sodium nitroprusside-induced relaxation in guinea-pig trachea: T.L. Hwang, et al.; Br. J. Pharmacol 125, 1158 (1998) Abstract
Methylene Blue--a therapeutic dye for all seasons?: M. Wainwright & K.B. Crossley; J. Chemother. 14, 431 (2002), (Review) Abstract
Methylene blue photoinactivation of RNA viruses: R.A. Floyd, et al.; Antiviral Res. 61, 141 (2004), (Review) Abstract
Methylene blue delays cellular senescence and enhances key mitochondrial biochemical pathways: H. Atamna, et al.; FASEB J. 22, 703 (2008) Abstract
Further Categories Containing This Product:
Guanylyl Cyclases, Guanosine Phosphate Metabolism / Related Products • Neurotoxins • Spin Traps, Spin Probes & Spin Labels • Dyes / Stains / Fluorescent Probes / Fluorescent Labels
 
 
ALX-400-014 Revised 29-Jul-08
MGD . sodium salt . monohydrate
Add to Clipboard
SYNONYMS N-(Dithiocarbamoyl)-N-methyl-D-glucamine . Na . H20
PRODUCT LINE Oxidative Stress
PRODUCT CATEGORY Spin Traps, Spin Probes & Spin Labels
Ordering Information
Product Numbers: Format: Size: Unit Price: Quantity: Add To Cart
ALX-400-014-M050   50 mg 50.00 USD Add To Cart
ALX-400-014-M250   250 mg 150.00 USD Add To Cart
Product Specification
FORMULA: C8H16NO5S2Na . H2O
MW: 293.3 . 18.0
PURITY: ≥99% (1H-NMR)
APPEARANCE: White to off-white solid.
SOLUBILITY: Soluble in water.
SHIPPING: AMBIENT
LONG TERM STORAGE: +4°C
HANDLING: Protect from light.

Product Description
Together with FeSO4 MGD is a useful component for the formation of the MGD2-Fe2+complex, which is an excellent nitric oxide (NO) spin-trapping reagent. The MGD2-Fe2+complex is quite unstable, especially in the presence of dissolved oxygen. Thus, the complex should be used immediately after being made. An excess (usually 5-fold excess), of MGD to Fe2+ is used for making the complex with FeSO4 to give a more stable complex solution. Acidic conditions should be avoided because dithiocarbamate tends to decompose forming toxic carbon disulfide. It was reported that MGD and Fe(MGD)2 do not exhibit toxicity up to 8mmol/kg and 0.3mmol/kg, respectively.
Product Specific Literature References
Sodium N-methyl-D-glucamine dithiocarbamate and cadmium intoxication: L.A. Shinobu, et al.; Acta Pharmacol. Toxicol. 54, 189 (1984) Abstract
In vivo spin trapping of nitric oxide in mice: A. Komarov, et al.; BBRC 195, 1191 (1993) Abstract
Spin trapping of nitric oxide produced in vivo in septic-shock mice: C.-S. Lei & A.M. Komarov; FEBS Lett. 345, 120 (1994) Abstract
Spin trapping isotopically-labelled nitric oxide produced from [15N]L- arginine and [17O]dioxygen by activated macrophages using a water soluble Fe(++)-dithiocarbamate spin trap: Y. Kotake, et al.; Free Rad. Res. 23, 287 (1995) Abstract
Continuous and quantitative monitoring of rate of cellular nitric oxide generation: Y. Kotake; Methods Enzymol. 268, 222 (1996) Abstract
Continuous monitoring of cellular nitric oxide generation by spin trapping with an iron-dithiocarbamate complex: Y. Kotake, et al.; Biochim. Biophys. Acta 1289, 362 (1996) Abstract
Complexes of Fe2+ with diethyldithiocarbamate or N-methyl-D-glucamine dithiocarbamate as traps of nitric oxide in animal tissues: comparative investigations: V.D. Mikoyan, et al.; Biochim. Biophys. Acta 1336, 225 (1997) Abstract
Redox properties of iron-dithiocarbamates and their nitrosyl derivatives: implications for their use as traps of nitric oxide in biological systems: A.F. Vanin, et al.; Biochim. Biophys. Acta 1474, 365 (2000) Abstract
Electron-paramagnetic resonance spectroscopy using N-methyl-D-glucamine dithiocarbamate iron cannot discriminate between nitric oxide and nitroxyl: implications for the detection of reaction products for nitric oxide synthase: A.M. Komarov, et al.; Free Radic. Biol. Med. 28, 793 (2000) Abstract
Detailed methods for the quantification of nitric oxide in aqueous solutions using either an oxygen monitor or EPR: S. Venkataraman, et al.; Free Radic. Biol. Med. 29, 580 (2000) Abstract
EPR spectroscopy of common nitric oxide - spin trap complexes: S. Nedeianu & T. Pali; Cell. Mol. Biol. Lett. 7, 142 (2002) Abstract
Redox cycling of iron complexes of N-(dithiocarboxy)sarcosine and N-methyl-D-glucamine dithiocarbamate: C. Lu & W.H. Koppenol; Free Radic. Biol. Med. 39, 1581 (2005) Abstract
Evaluation of lipid-based carrier systems and inclusion complexes of diethyldithiocarbamate-iron to trap nitric oxide in biological systems: N. Charlier, et al.; Magn. Reson. Med. 55, 215 (2006) Abstract